PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010112889.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 283aa    MW: 31205.2 Da    PI: 8.4503
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010112889.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like45.22.1e-1466952655
         G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     AtPk++l +m+vkg+tl+h+kSHLQkYRl
  XP_010112889.1 66 GATPKSLLGVMGVKGITLYHLKSHLQKYRL 95
                    59***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-126596IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-96696IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MRGNNGKFSA INDSLKEQCH VEVSIFWSQK ATTTATAAAM ASSTPMEWRS THNRSLHDEI  60
GRVTRGATPK SLLGVMGVKG ITLYHLKSHL QKYRLGKYSI KEWTQVPKKG SSSSLDITTL  120
GFLPCHQAEG YELIDEGLEL QKEIQAKLNL KIEASLQITT SHKDPELAER RLQMCQEAER  180
RYLNTALGTA RKMLANPYVM SATAGTGVVF EQDVTDLGTT PQRETHSLAG DSQTPYGNFA  240
SLSSEAFPSL AQGRKKRVQS LDEDPAETYL ILDNTQSGKQ NGI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112889.10.0hypothetical protein L484_017725
TrEMBLW9SC840.0W9SC84_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1890145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.15e-18G2-like family protein